DPCstruct | MC52216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 207 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.26 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0114- CL0192- CL0110- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817MVF8 | 7-210 | QHVNRTGVYFLADEHRKLYPAYSRMSIHDLIILLLPRWRSMTLVQRKPYEDLAKQYKRTRMLNNENVITPVIPSSEEVSFIEKNINE… |
| E4YFN6 | 1-234 | MDDYIPELRRQGIVIDHKQEAVPYLLADWKALSKEEKAPFEARAEEWKIATHGRNARPDHEKLNCFGIPVVNQIDYDIETKKNEEIA… |
| J9M1U3 | 1-197 | None |
| A0A2J7PG07 | 7-213 | None |
| A0A2P8Y5D4 | 9-208 | None |
| A0A2G8L7G9 | 1-216 | None |
| A0A182U671 | 1-203 | None |
| A0A044VG44 | 5-215 | None |
| A0A814VRM3 | 291-483 | None |
| A0A1W1ELL0 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.