DPCstruct | MC5221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 183 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0041- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1VWS5 | 1-186 | MNIPEFEYIADHLTEEECRHLVAALHFVSYDLPASLSAAERKVPLDVPCINLLLQWNSGKEKWEGYGKGHEEVAHRLRQLGKRDLAD… |
| A0A7F5RKU1 | 30-210 | TIDLNLPELQYLADHLHKEECKRLVAALHFKSYDKPCLLDLAENKVPSDPTCLELLLHWNSTPGEGKGETHEILLHRLRQIGRDDLA… |
| A0A0L7K4N7 | 23-226 | None |
| A0A8B6BN83 | 19-196 | None |
| A0A6V7HEW1 | 28-220 | None |
| A0A653BLZ1 | 22-207 | None |
| A0A2R7VUC1 | 11-188 | None |
| A0A1D1VTE3 | 8-230 | None |
| K1REA2 | 145-321 | None |
| A0A7J6ZQ52 | 3-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.