DPCstruct | MC52209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4Z021 | 21-140 | TCNDQEINNECLVVCDGEFFECTKNCGNSECSRKCIDELDVCENSCPCGADCPTGCVDCPEHPLCEDECEDAQLNNNDYKICLNEAI… |
| E4XXU2 | 6-125 | KSTDQEINNECSAVCDAEFFDCSKNCVNSDCLRKCAEEVIACENSCPCGADCPTGCVDCPEHPLCVDECEDAQFINNDYKICVNAAI… |
| E4Y0F8 | 3-127 | None |
| E4Y0X2 | 38-157 | None |
| E4Y0F7 | 22-141 | None |
| E4XPA7 | 1-149 | None |
| E4XKD5 | 19-142 | None |
| E4X193 | 7-132 | None |
| E4WT36 | 5-127 | None |
| E4XR14 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.