DPCstruct | MC52207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 182 ± 32 aa |
| Standard deviation of domain lengths | 31.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.29 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | CL0548- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4XXE3 | 9-202 | NDKHSSVKNILVDDVERIWAAFCNYILNQLTEQVGVKIKNLGVITVKSLNLDVGRRNLSITKPSFILDEKQSQHYGIKYGRPFTSYQ… |
| A0A2G9SQW9 | 2-175 | SSTLSVIAKSLAPVLGVPEAKVSEWLQIVMYRVCEELLLSGTAQLSGIGVVRKAHVPSRPVEREDVILVTPPRYSVELMPESDDSNG… |
| A0A7Z9G8H8 | 2-155 | None |
| A0A2T8HFA2 | 4-156 | None |
| A0A2P4SMX1 | 2-121 | None |
| A0A2P4S756 | 38-176 | None |
| A0A813Q7K9 | 19-227 | None |
| F3ZNA3 | 4-200 | None |
| A0A6G0RS16 | 12-206 | None |
| A0A5J4V8T7 | 7-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.