DPCstruct | MC52204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 228 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4Z447 | 2-228 | EKWLKGFLAKLKRTSTRTQKCRLISSVERMKFEEDVHACLWQYVRFGEDEGEIFNKNKISLEKIKLTDYQKVLLKSDDSLKDRFLSR… |
| E4XST3 | 37-265 | RENGKNEIEKWLEGFLAKLKRTSTRTEKCRLILAVERMQFEDDWYAAWWKHVRFGEENVKILDTGINVGKKDLQKIKITEFQKELLK… |
| E4YMZ2 | 1-226 | None |
| E4Y7V2 | 11-233 | None |
| E4Y743 | 1-233 | None |
| E4XZJ8 | 12-246 | None |
| E4XNS7 | 4-231 | None |
| E4XR09 | 8-218 | None |
| E4XL99 | 12-252 | None |
| E4XDQ5 | 12-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.