DPCstruct | MC5220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 204 ± 28 aa |
| Standard deviation of domain lengths | 28.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.34 |
| Pfam Score | 97.30 |
| Assigned Pfam label(s) | CL0709- CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F5RKR3 | 21-236 | LLEFLKLDECPISTSIKLSDFHGLDYGSGMATSFFHGYLKIMLPNTGGSSRSFLEFIELYQAQHKVTFDVRKLFILLPMSCECFPSL… |
| A0A1S3KHL2 | 2-190 | TAAASEIKNSMGYGLAWSYYYGYLKLILPGLADRVKTSTFWDASNQRIAPKLFILLPTSCFAHPTLTDGDSAVQPGAHLREFKANRS… |
| A0A4U5UF42 | 112-316 | None |
| A0A813VF92 | 573-837 | None |
| A0A2B4SJZ1 | 73-293 | None |
| A0A1G7HD72 | 204-395 | None |
| F6YSF5 | 3-182 | None |
| R7U4R8 | 23-205 | None |
| A0A2P8XUZ3 | 540-756 | None |
| R7T8P6 | 600-833 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.