DPCstruct | MC522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G6K5G1 | 35-143 | NVSNIVNYTPARKILSPNEYYNLFIIYGEQYERDSFTIENGRIFEYTNTAISQKFNQFTLEEIDEIMSLPTLFLPEYSDSNQEIKTG… |
| A0A2T0U472 | 1-100 | MYNLFISGSDEDFEGTPFEIDQSRAFEHTNGELKSSYEALTANQVNELKKHPCIFAYETGSEKPPKYGMLKGVKKRQKMLLIEYEII… |
| A0A291DWI4 | 1-87 | None |
| A0A178Y6T2 | 1-104 | None |
| A0A2E2RPF1 | 116-208 | None |
| A0A2N6T7W3 | 1-82 | None |
| A0A521H2P8 | 1-94 | None |
| A0A6B1EYT9 | 111-200 | None |
| A0A845GSG2 | 1-93 | None |
| V7F897 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.