DPCstruct | MC52198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 55.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6V8Q3 | 1-92 | MATRTSGFALLCSGSVQEAHDLALIATAATLKSRIPFVQYFDGFRTSHEIAKINLLSADDLRALIDEDAVRAHRQRALSPDRPVLRG… |
| A0A4R6Q3S9 | 135-225 | ATRQTGFAMLASCSVQEVMDLGAVAHLSAIKGSLPLLHFFDGFRTSHEIQKIEVLEYDELKKLVDTDAVDAFRARALNPDHPVMRGT… |
| A0A349M342 | 4-87 | None |
| A0A484ZCM8 | 1-106 | None |
| A0A376UA08 | 1-112 | None |
| A0A377M166 | 40-144 | None |
| A0A377E4C1 | 1-106 | None |
| K1UDP2 | 2-87 | None |
| A0A2C9KDX5 | 93-183 | None |
| A0A4U9CVI9 | 90-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.