DPCstruct | MC52193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 297 ± 53 aa |
| Standard deviation of domain lengths | 52.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443PDW8 | 1-285 | MHDLKEIGSILYWMGLLDIVMREIETTQFMQIAPWLGLIPGTDEQVQQAQDVKNSPIVSLFKSATSVIVSHPRCPSPSSFFTMSKQA… |
| A0A6F9BPF6 | 174-368 | LREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTK… |
| A0A3P7YBM3 | 150-487 | None |
| A0A0L8IGD7 | 2-312 | None |
| A0A1U7Z0X0 | 42-388 | None |
| A0A7C8Z689 | 35-319 | None |
| X6MM33 | 744-1082 | None |
| A0A4S4EWN8 | 2-292 | None |
| A0A1X7SSM3 | 2-200 | None |
| A0A2D4BT65 | 17-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.