DPCstruct | MC52191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 62 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.70 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0092- PF04815 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C460 | 80-133 | IQPSLTAFNLDGSEEPVLLDTSSLQPERVLLMDSFFHILIYEGDTISKWKKAGY |
| A0A0A9JMW5 | 128-176 | IQPSLISYSFQSGPEPVLLDVTAITADRILLLDSYFTIIIFHGIAIAQW |
| A0A836D842 | 345-409 | None |
| A0A396HEH9 | 81-152 | None |
| A0A5C3P9V9 | 174-219 | None |
| A0A7J8WBL3 | 1-69 | None |
| A0A835D855 | 177-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.