DPCstruct | MC5219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Standard deviation of domain lengths | 33.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7AZI1 | 11-176 | NHTATECALNDLADNQIRDVANFMGHAIDIHNNIYRRPVEKRDVLQMSQILEESLETNERDEQLSDESSEIEDCNLPLDSDSEDYTP… |
| A0A7F5RJW5 | 27-224 | FRKHIATTLQLMSLDETEIEQIATFMGHTKKTHAEFYRLPQDIYQTAKVAKVLMLLEKGKANEFKGKSLGEIHLSNDVYYSSESDEC… |
| A0A7J5Y0Q7 | 315-505 | None |
| A0A444T9F9 | 30-272 | None |
| A0A653CHN7 | 543-726 | None |
| A0A6P3VKM5 | 680-934 | None |
| A0A7J7A0W2 | 2-169 | None |
| A0A7J6ZAJ7 | 15-197 | None |
| A0A7J6ZFG6 | 49-188 | None |
| A0A4C1TLU0 | 3-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.