DPCstruct | MC52186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 171 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2ZEE7 | 1-186 | MAEHARNRTAAPNAPRSVSKATSTCEYCSKKFTTRGKTPHQNLCKKKQKHVEATAKPPFQFPIHNNTVFEYLLKFMSNQTLIKLEIA… |
| G4YP17 | 2-151 | TRHQNKCAEKQAHDIAEAKKPRCYRFSIVDEGVFENVLKFLGNQTLTKLQMLTGDRYDQCEPELAKYCCKCENDNPVILHGLCRECE… |
| A0A833X188 | 1-196 | None |
| A0A329RHZ5 | 1-148 | None |
| H3HC75 | 6-192 | None |
| A0A833T881 | 1-189 | None |
| W2ZFH4 | 5-189 | None |
| W2QB91 | 6-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.