DPCstruct | MC52170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 195 ± 43 aa |
| Standard deviation of domain lengths | 43.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7T097 | 54-229 | LQLDAIIITCWIILNAICVACGLQKGGRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQG… |
| A0A2T4RMP4 | 1-130 | GLGTILMVAALIVGPTVLILNMLTSSTGSLLNTFLFNSFDTAALNPQKREWMSSWTLYYWGWWLSWSPFVGVFIARVSKGRSIREFI… |
| A0A7W3R481 | 16-136 | None |
| A0A0F9I5P7 | 4-252 | None |
| A0A7W4MH66 | 3-177 | None |
| A0A1K1YWE9 | 20-195 | None |
| A0A7M5UUX0 | 189-448 | None |
| A0A2M9AJI4 | 113-387 | None |
| A0A7W7L2F8 | 3-125 | None |
| D7WFC4 | 6-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.