DPCstruct | MC52169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 220 |
|---|---|
| Mean domain length (aa) | 149 ± 29 aa |
| Standard deviation of domain lengths | 29.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 88.72 |
| Assigned Pfam label(s) | PF11535- PF13817- CL0219- PF13007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7G891 | 180-364 | TLLSDDAPQFKQIAYHHALCWIHDGRNYKKLRPIVPYYQEKLEAFLDNYWDFYGELCEFREKPDSEVAKQLSAKFDQFFSTKTGYEQ… |
| E7SS70 | 8-167 | AHARRKIHDEDVRRPTEMTQEALRRIAELYDIEAEIRGSPAEERLAVRKARSVQLMQSLYDWIQLQRKTLSKHAEMAKAFDYILNHW… |
| A0A7H1N1L9 | 342-503 | None |
| U9Z4Z9 | 14-249 | None |
| A0A4Q3MVV8 | 10-117 | None |
| A0A840GYR3 | 10-145 | None |
| A0A0P8YME0 | 2-99 | None |
| A0A1Q3MYJ4 | 365-561 | None |
| A0A5E7Q8J1 | 47-202 | None |
| A0A501XVX7 | 311-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.