DPCstruct | MC52166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 63.98 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0357- PF14712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8Q7Y6 | 4-101 | QAATAQAAATAQAAAVAGSIPGPGSVGGIAPAIGLSVAAGLGVDDLRRLCLVRLSFVKGWGPDYPRASITCTPCWIEVHLHRALQLL… |
| Q2L6Y5 | 80-183 | ESSFTVFDIRWAYMQMLRRSRSSNEAVRAQAAAVAGYAPMSVMPAIMPDSGVDRMRRDFCTIAISFVKAWGDVYQRKTIKETPCWIE… |
| A0A226MD68 | 133-225 | None |
| A0A0N5ANC1 | 322-423 | None |
| S7QBV3 | 78-174 | None |
| A0A821J6M7 | 406-496 | None |
| A0A6P8SVY3 | 338-424 | None |
| A0A183TXL3 | 1-96 | None |
| A0A835NGJ8 | 102-203 | None |
| A0A553PH47 | 486-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.