DPCstruct | MC52163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 74 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432IMB9 | 1-74 | MFLRKKKNKSGSISIQIISKSGGKYKVIKTIGCGRTEQEVQKLEYLGKQELEHLSFQPKLFVSETDTMIDSIFD |
| A0A4V1J939 | 1-56 | MFLRKKKNKSGSISIQIISKQRGKYKVVKTIGNSDNEQQIQKLVFLGKQEIERLNG |
| A0A7K0KD00 | 1-78 | None |
| A0A348W4L5 | 1-114 | None |
| A0A382THD4 | 5-93 | None |
| A0A4P8LBI7 | 66-128 | None |
| A0A1H4A4P6 | 13-80 | None |
| A0A7I7STG4 | 1-71 | None |
| A0A1J5B2N1 | 1-63 | None |
| A0A1J5FXP7 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.