DPCstruct | MC52160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G4XA47 | 22-107 | RLGMLRYATEKFREKAPKTYAYLDGGNADWVAAGTTPDQLEAAGIRNVWGFAVNVSNYYTTSASASYAQNVAGGLGYDAKFVIDTT |
| D9UC73 | 47-155 | ILEPDAIAQSGCLPAADRAARFASLERAARVLKAAGPRTRVYFDAGHSGWLEPDRAAALLRQAGAARAGDGIFTNVSHFHRTADETA… |
| A0A7X0RGM0 | 99-207 | None |
| A0A327Z669 | 991-1097 | None |
| A0A505DSG9 | 64-143 | None |
| A0A100JDB2 | 16-102 | None |
| A0A060C3D4 | 1-91 | None |
| A0A429CJ72 | 1-144 | None |
| A0A1S1HM35 | 134-243 | None |
| A0A7Y8TNT3 | 133-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.