DPCstruct | MC5216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 50.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418B1H7 | 77-211 | TTKNRNARIEAMLDVLSRPKQWQMSDGIIKPVDTPFTVRAKELTELYHGLKLPLRNVEERLEVLLHVKWTVKEFECALTKELMELID… |
| A0A7S3H5A2 | 125-255 | QRELQVEKTQQMLERMSMPHVWQLSRGEAAQVYTPETQRAKELLDLFNALNAPLLGTDQRLDVLLNVKWTVKELESPLTKEIMELVD… |
| A0A024G4P3 | 769-899 | None |
| A0A812WGR8 | 465-603 | None |
| C1E0T6 | 454-587 | None |
| A0A2P6NG32 | 539-680 | None |
| A0A7S1GAU3 | 221-372 | None |
| A0A7J6P167 | 152-295 | None |
| A0A7S1QQ64 | 321-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.