DPCstruct | MC52156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 316 ± 45 aa |
| Standard deviation of domain lengths | 45.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0105- CL0159- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813DTX9 | 1-393 | LAGPSPNKTLKVCGYAYTGGGNKIIRGEISLDSGKSWEIANLTRPEDEIAAARGTDKHWCWSWFETEVDVAKLEGCHEICCRAWDSN… |
| A0A2I1EWX8 | 146-415 | WWYIPNYIIYDLNVNSAIAAPAHDEVIPFSSFSSDSEYTLRGYAYSGGGRKITRVEVTLDDGKTWLLSDLFDLEERNGRTWCWTFWS… |
| X0AKW5 | 490-762 | None |
| A0A835FV95 | 310-621 | None |
| A0A3L6RJ70 | 227-505 | None |
| A0A397J0C0 | 233-506 | None |
| A0A7J7IE29 | 20-401 | None |
| A0A7R9YHQ0 | 1-360 | None |
| G2R5E5 | 312-581 | None |
| A0A813GQG1 | 415-762 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.