DPCstruct | MC52155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 274 ± 20 aa |
| Standard deviation of domain lengths | 20.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813DPY6 | 26-341 | GASKGLRAAGGFLSGPDLQDDLRQAVVETLGGGNRTLDATREKLRPMWSALAKNQQGRIDRRSLRYALHRYFLHAHSLSLVGLEPLQ… |
| A0A813CTS9 | 2-266 | LQAALRQGLVKVSADRLLHVEESLRASYEAFPKDARGNVPPHQVLPALARAYFSKEHGWLVRGLESPGAPVIAPGESHQDARPSVTA… |
| A0A7S4PXJ7 | 1-253 | None |
| A0A812KES5 | 15-265 | None |
| A0A812NQU6 | 9-291 | None |
| A0A1Q9EJN2 | 456-725 | None |
| A0A1Q9E6L4 | 305-597 | None |
| A0A812XGR2 | 38-342 | None |
| A0A812GE18 | 708-967 | None |
| A0A812YDG2 | 2-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.