DPCstruct | MC52151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 237 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813DC75 | 1-225 | MLELLYSSAAKACLENYWRDESFREFYLGGKAKWKKLPNESELLAMTVAGMNYPPSQYQLHLQFIHGPLLPFHYALFLEGGHFHYKR… |
| A0A7S2TKB0 | 139-371 | TPCHVDAIPTSTYIPDLRMLFADSKRGLKLLNQLESHCHKVVTTQFLSNKAWASKMIKGGDSVDAKTVTKHLITGLNFPPSQYWLHL… |
| A0A6T8DBT9 | 143-386 | None |
| A0A7J6L1P5 | 283-505 | None |
| A0A813EZI7 | 549-782 | None |
| A0A812MZM4 | 168-423 | None |
| A0A7S1MMQ9 | 1-259 | None |
| C5M0L7 | 130-356 | None |
| A0A7S2FY31 | 765-997 | None |
| A0A813I592 | 214-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.