DPCstruct | MC5215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 248 ± 27 aa |
| Standard deviation of domain lengths | 26.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14895 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0VUP0 | 1-246 | MSISSLLFRGLKGGQGVWNDINNELELISLTKEKKLKKKKEKKRTTGINGLTYATMKVDLTFKSTVSDVELMNFRHYLKKKNLGRED… |
| A0A7F5R9B9 | 1-255 | MGEESTQFASGTWTWDDLTNELTFQSANQDDQQGTAQGQTATKVVVQSAFEVKFRDTVDNVEKIRFRRRFQRKAKIGTTSYIILQDI… |
| A0A7N8YLU4 | 1-188 | None |
| I3M1W4 | 1-256 | None |
| A0A2K5YJ48 | 16-291 | None |
| A0A821CKE5 | 10-257 | None |
| A0A074Z3I2 | 1-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.