DPCstruct | MC5214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9AA09 | 2-56 | AMTYWRQAGLNYIQFSAIAAKIVRRALKAPLRAEALRREEINVKINPWKDGKPVK |
| A0A7F5R988 | 1-54 | MSAWRAAGLNYTRYSQISAQLLRQALKKEFKADAEKRGATHIKFTRWADGKPIS |
| A0A383UZH4 | 1-59 | None |
| A0A835JTZ6 | 45-105 | None |
| A0A0L9UWR9 | 4-59 | None |
| W5MGV4 | 1-49 | None |
| A0A2K6ULX3 | 2-52 | None |
| A0A835HKT9 | 2-67 | None |
| A0A445AQX2 | 1-54 | None |
| A0A165N8M1 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.