DPCstruct | MC52130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 130 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351TLI4 | 1-124 | MELKITGEKGARISKDFIGLFIEDINYAIDGGLYAQLIENGNFESVEAFGGKDKDYYVKQDGLYAWGVYPESSDTRLSIVQGSPVSV… |
| A0A355IR56 | 1-99 | MSIDLNQTGVPMSQDLIGAFFEDINYGADGGLYAELVQNRSFEYYAVTGYTNQGPLTAWTTVQEGGAQVTLAVENQAPLNSSNTNYL… |
| A0A060BYT2 | 15-145 | None |
| A0A4Y7QIM3 | 2-121 | None |
| A0A444CF39 | 87-242 | None |
| A0A5J5DTB7 | 1-105 | None |
| A0A820MN93 | 4-123 | None |
| A0A396H8Y2 | 25-146 | None |
| A0A6A4NMT7 | 23-132 | None |
| A0A1D6QH30 | 73-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.