DPCstruct | MC5213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 219 ± 54 aa |
| Standard deviation of domain lengths | 54.27 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834P729 | 707-880 | MSRPRIRVKFFRWWIRKLWILSTIDRLFFPLVLYALYLIVGPWAIGEVIENHIGIIFAWGTFVGNSFLPGAFTYAYGFFQLFSFHLP… |
| A0A7F5R6X9 | 85-262 | ILSTVDRLFYPLICYCIYLPVGPWSVGYLVEDHLGAIFAWGILVNGNFLPGSFTYAYGFVQLATFQFPLILILANGVDNRLRNLILR… |
| A0A2A3EKL9 | 419-681 | None |
| A0A814DMW9 | 494-651 | None |
| A0A817NWA5 | 1-198 | None |
| A0A3L8D837 | 1-162 | None |
| A0A4E0RUY3 | 468-610 | None |
| A0A498IGU6 | 836-1110 | None |
| A0A077WSQ9 | 188-440 | None |
| A0A6P6FY06 | 71-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.