DPCstruct | MC52126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 613 |
|---|---|
| Mean domain length (aa) | 93 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.66 |
| Pfam Score | 99.69 |
| Assigned Pfam label(s) | CL0481- CL0350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9EGK4 | 7-102 | LSATSIVGTKVVNNQNENLGDIKDLMIDTNRGRIAYAVLSFGGFLGMGDKLFAIPWPMIKFDTVDEHVVLDVSKEQLENAPGFDKDN… |
| A0A7C7KPH7 | 48-153 | TDFHVEERDPDPRGMTVLGADGQAAGTITDIWVDRGEFVIRFLEMAVAGTEGRKALLPIAMVVVNGKRRTVTVAALLSNQFAGIPAL… |
| B9XC99 | 53-169 | None |
| A0A316KGD2 | 8-122 | None |
| A0A1Y5TI93 | 1-108 | None |
| A0A5M8PBN3 | 102-207 | None |
| Q1AZA4 | 1-91 | None |
| A0A852WEQ5 | 7-79 | None |
| A0A254TLQ1 | 31-146 | None |
| K8F337 | 243-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.