DPCstruct | MC52121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 212 ± 28 aa |
| Standard deviation of domain lengths | 28.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF21231- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2IPQ9 | 2-198 | PAKGINPNQLKFVAPQLENLIYLSGSSFSPVHDIEVSGLRFMYTAPTFMKTSEPLLRSDWTIYRQGAVKIEGAENCIFRANDFIALG… |
| A0A7W9HKA5 | 265-473 | PRAGENMSTAIVQAPTLETLFRIKGTDLDNPLHNLNFSGITFTQTTWMEATKHGLLNGQGGNYNLSADTNNNQYVDRPPAGVYVAYA… |
| R1BN02 | 172-343 | None |
| R1CFJ3 | 175-371 | None |
| A0A7X0GXI3 | 36-230 | None |
| A0A3A1TWC0 | 235-431 | None |
| A0A819GNM3 | 297-482 | None |
| A0A4V0XR61 | 260-485 | None |
| A0A813D087 | 149-370 | None |
| A0A5A8BYX2 | 32-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.