DPCstruct | MC5212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F5R3G3 | 1-79 | MLLKQYPCMWQGLLALKNDQAAVQMYFVSGNEQVAKCSLPKNIDGSTPPLRIFQRMRLEPPQVEGVARKMQVVYSSFFL |
| A0A5E4D8G2 | 63-133 | ILKKYPIVWQGLPALKNNTAAVQLHFVSGNNVLAHQSLPLSEGGPPLRITQRKWLEASQLEGVARRMTVKT |
| A0A183E7F5 | 63-136 | None |
| A0A7R8CJW8 | 326-408 | None |
| A0A7M5TYE7 | 710-784 | None |
| A0A183S796 | 45-119 | None |
| A0A226D9G2 | 2-68 | None |
| H2XTQ6 | 78-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.