DPCstruct | MC52114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 192 ± 29 aa |
| Standard deviation of domain lengths | 29.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05612 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7I3R7 | 28-217 | LYPPFWEDTSGEISGFALEDGKYIINPWVFTDRMGLYKILLSKTAPYFAKYGPENEQNLLWGLPMQFGWQYRTGRLVDPTGRTTCGY… |
| A0A2P8HZQ9 | 3-167 | HPEELAALDLYPVWTTAADPAGTFDPFRFEQRMAAYRLMIGNTNPADRFGADNRHNPLWGLMFQHQWQLRTGRLGADARCDGRIDPD… |
| A0A0E9WMA5 | 1-188 | None |
| A0A674J293 | 28-209 | None |
| A0A670HYN1 | 45-268 | None |
| M7BTP9 | 150-372 | None |
| A0A821CUQ4 | 13-183 | None |
| A0A671YGJ5 | 50-289 | None |
| A0A7S1YV98 | 4-163 | None |
| A0A668VHY8 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.