DPCstruct | MC52113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 332 ± 84 aa |
| Standard deviation of domain lengths | 84.29 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.27 |
| Pfam Score | 97.47 |
| Assigned Pfam label(s) | PF00162- CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7HXL3 | 2-331 | MSVDFNVPMKNNQITNNQRIKAAVPSIKFCLDCGAKSVVLMIHLGQTDGVPRPDKYFLEPVVEELKSLIGKDVLFLKNCVVLEVENA… |
| A0A354EKZ4 | 2-231 | ENIKFYKEEGENDASFSAELAENFDIFVNESFSDSHRGYVSTVGVAKRLPSYAGFQTQKEVENLSRVKDHPEHPAVAIIGGAKIETK… |
| A0A1W9P5L0 | 142-629 | None |
| A0A6V7PAV2 | 77-429 | None |
| A0A1A9X7I2 | 1-181 | None |
| A0A0G0CIW9 | 464-827 | None |
| A0A2C9K4E8 | 144-557 | None |
| A0A835HCX6 | 3-345 | None |
| A0A7C9DNV3 | 16-295 | None |
| A0A7C0WZ11 | 29-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.