DPCstruct | MC52112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 265 ± 30 aa |
| Standard deviation of domain lengths | 29.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7HX35 | 25-308 | GASSTFAFFFSEKFLRQHFQEVELDQGDPQPGDLYVFQLQSSKAQWCGAHVGVYCGHGEIIHFEGRTSRGSRLQMLLKYCDGMVHKE… |
| A0A1M5B3L2 | 1-253 | MFGDFLHEEKRYLLDIDDIYDLDNGTVIVAEYSRFEYQFGIFGKHHVIYQACWTTKDKILVFSIEKCSIEDFFKEADVYEYIPDFDY… |
| A0A5F8AM68 | 1-234 | None |
| A0A6J8BFX1 | 212-489 | None |
| A0A3M7PPB7 | 12-238 | None |
| A0A8B6CZ17 | 24-329 | None |
| A0A7N4NTS9 | 72-305 | None |
| A0A6J3DHC3 | 16-291 | None |
| A0A814JCU1 | 2-249 | None |
| A0A803JV81 | 168-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.