DPCstruct | MC52111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 85 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.10 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0431- CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7HWY1 | 1-103 | MGAHLAWRYVGDASVETDPLQMPSFPEHKEHVRVATQQEMNDAQLTLQQHDYCAHYLIRLPKCKWDSFPNFLACKHEQHDWHYCDHL… |
| A0A6T9HKM8 | 34-107 | PEMKVTREQMRDARVPLHFRDYCAHILIPLNECRHKTWFAPYKCTDLRHAYEKCQYDEFQRRVRIAQAEREDAR |
| A0A7J5Y6Z0 | 22-125 | None |
| L7JI42 | 300-372 | None |
| A0A6P4Z6U5 | 7-117 | None |
| R7QRG1 | 64-160 | None |
| G3JV18 | 197-266 | None |
| A0A182FI73 | 1-111 | None |
| A0A7S2XJH9 | 38-128 | None |
| A0A7R8X932 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.