DPCstruct | MC5211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F5R0F7 | 9-84 | ICAIAAFILFIDHQKTIGAVAVERVKRADGEKYTTKYDNIDIDRILTNERLFKNYKNCILDKGKCTPDGQELKSKF |
| A0A182H2P9 | 2-63 | KVVILFALIAMAIAQDSYPTKYDNIDVDEILNSDRLFKNYFNCLMEAGPCTPEGNELKKYLP |
| T1GAC0 | 1-68 | None |
| A0A1B0BQW0 | 39-102 | None |
| A0A482VHR0 | 1-71 | None |
| A0A482VJY4 | 1-73 | None |
| A0A7R9B2X2 | 1-73 | None |
| A0A6L5D4M8 | 1-72 | None |
| A0A194QVW8 | 41-113 | None |
| A0A7R9HMG3 | 14-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.