DPCstruct | MC52109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9ZFZ2 | 8-81 | NALPDVDHLRSFLRYDPNTGIVTWLINAASSVRSGSEAGTLGADGYLRIVINRKSYALHRVIWKLHYGSDPILR |
| A0A2E0FHH7 | 12-83 | LPFDSIEHANEYLKLSENYPSGLEWVYEDGWRTKGEMCGKWNATGEYYVVRLFGEQYHAHRIVYYLRTGEDP |
| A0A386YDW1 | 1-73 | None |
| A0A259MG58 | 25-95 | None |
| A0A2D5FGM2 | 113-192 | None |
| A0A377LWZ1 | 1-71 | None |
| A0A2V2RCL7 | 1-70 | None |
| A0A264VLE7 | 1-71 | None |
| A0A1I7WCZ2 | 251-317 | None |
| A0A2N8M913 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.