DPCstruct | MC52108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 132 ± 19 aa |
| Standard deviation of domain lengths | 19.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9ZE49 | 6-122 | VSCRCCSLTSRFRLQHLLPLNPQAFPAVINRQAFETAASFTSNTNWQSYSGESTMSYFSQMTQLAFHNFVSGAVGMAIAVAVARAGK… |
| A0A2X3JN08 | 69-217 | LNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTAVSFVTNTNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAF… |
| A0A838DAZ3 | 2-100 | None |
| A0A377GL00 | 73-228 | None |
| A0A1V4TRG9 | 295-443 | None |
| A0A534N902 | 343-495 | None |
| A0A7I7SM77 | 61-205 | None |
| A0A399WWU5 | 72-174 | None |
| A0A1I5TKM9 | 70-194 | None |
| A0A7W8FLV2 | 61-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.