DPCstruct | MC52101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4RYT7 | 2-119 | NITEGVTFEGASLSLKSETTLSLYFRSSAGVLEFSCSDGKTVEKAAPGNYQVARIRGIKASELGKTFTLTVTVGGTDYTVNYGPMIY… |
| A0A1T4KML2 | 77-207 | KTIANPTARWRTSALVLDNSVMLRAKFSADNIENKTVEIICNGRTFTYTKNDFVDNGNGTYYVCCDELYADEMSDDIFLTVYENGVP… |
| R7A533 | 29-159 | None |
| A0A315YH34 | 227-332 | None |
| R6J0E9 | 6-142 | None |
| A0A1G4S898 | 1-106 | None |
| A0A3B9IWR6 | 787-897 | None |
| A0A1G4WQC3 | 309-428 | None |
| A0A1G4WZZ7 | 279-393 | None |
| A0A1G4W3B6 | 142-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.