DPCstruct | MC5210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 14.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4KZP9 | 5-90 | TPILEGEFEILRVTPDLYDDVEELLTRISLEEEFGCLATRLKESPLAVSEFRTLIRHILTLGVSFAIRHVKSGSIVAAIASLVYIE |
| A0A7F5QZ20 | 2-96 | SSRVWSTTSNGEIEVVSLTAEKLEESLHVLRVGFFPQENVCRATQVAQNLNAMKELENLCVDVAKEGCSIIAIDRITQKVVGVAFNK… |
| A0A834NMS7 | 48-129 | None |
| A0A1A9XBM4 | 80-181 | None |
| A0A3Q0J5T6 | 1-102 | None |
| A0A7E5W1K9 | 486-609 | None |
| A0A4C1ZL86 | 11-129 | None |
| A0A2P8XJF0 | 148-268 | None |
| A0A0N5CRH4 | 9-93 | None |
| A0A194PI18 | 8-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.