DPCstruct | MC52098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q0A9D0 | 269-358 | LRNPAVDTLIDGLVSANTRNDMVLYARALDRVLQWGYYMIPNYYSKGTPLVFANRFGMPDVAPIYDVGLETWWQISPTPLTNAQATA… |
| A0A109LEW2 | 2-74 | EELIDAGSRQSLIAHARALDRVLQFGYYVIPNWHIKTFRVAYWDHLGHPKVSPRYDVGTATWWSKPDVTPAVP |
| A0A3S9JXS6 | 2-79 | None |
| A0A855HVL9 | 158-243 | None |
| A0A6B0YEQ3 | 4-61 | None |
| A0A2X4UUV8 | 55-135 | None |
| A0A6N8K9Z0 | 2-58 | None |
| X1L7D8 | 19-88 | None |
| A0A7X6EKQ1 | 107-183 | None |
| A0A6N3TFP3 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.