DPCstruct | MC52096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7YGP5 | 1-109 | MKESRVQDILVSLSALQYRRMDLHEFCAAVVSVHQLEALDRWEQHARSAYEYFEKEVNRAIVIDELASELGLSPSVPLHVILQDWIR… |
| A0A7G2EVX3 | 496-580 | LAHKKLDFEEFCAASVSVYQLEALEEWEQIATVAFEHFESEGSRAISVQELAEEMSLGPNAYPLLKDWIRSLDGKLNFLGYAKFL |
| D7L4B7 | 1-107 | None |
| A0A1R3IF74 | 86-179 | None |
| A0A2U1QKB6 | 272-367 | None |
| A0A5P1FM88 | 77-186 | None |
| A0A0R0H689 | 312-393 | None |
| A0A1R3HGV9 | 9-108 | None |
| A0A7G2EUD6 | 480-566 | None |
| A0A1R3JJZ0 | 283-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.