DPCstruct | MC52090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 60.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6Q3Q1 | 1-83 | MAEEPFKLLIVDSVIALFRVDFSGRGELEEREQKLAHMLSRLTKIAEEFNVEVYITNQVIADPGGGMFITDLGGGIFLFIFGR |
| A0A1X2HRD5 | 4-59 | QARFAILIVDSAMSLYRTDYAGRGELAARQTHLAQFLRQLQRLADEYGVAVVITNQ |
| A0A1D6LIT8 | 1-72 | None |
| A0A816L4B3 | 1-67 | None |
| A0A804PSK4 | 300-382 | None |
| H3GKR7 | 699-771 | None |
| A0A103Y2Z9 | 360-440 | None |
| M5C4R1 | 63-139 | None |
| A0A6A6KCA8 | 1-78 | None |
| A0A2P6QLD7 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.