DPCstruct | MC52080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 247 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1BC35 | 1-216 | MARLVIVVEKSTDWGSYYPSDNVVPATDYLREPVGGDERTHVINLCRSYKYLGTGYYVSLLGEARGHRVIPSVRTINDLRRRSLYGL… |
| A0A2R7PVW5 | 1-246 | MSTYVIVEELGDWPCHANYLLTARTYLQHGVPTTGGRPRIINLCRNLEHLSAGYYCSLLAQARSHHCLPGLQAISVLQPQQPPAKLW… |
| A0A2E9IXG6 | 1-248 | None |
| A0A7V8VTP7 | 3-269 | None |
| A0A2W5MYE9 | 16-274 | None |
| A0A3M3D1T9 | 127-384 | None |
| A0A433J5R6 | 102-316 | None |
| A0A3D4P9Z3 | 161-413 | None |
| A0A060UT25 | 3-257 | None |
| A0A2N1XAZ8 | 1-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.