DPCstruct | MC5208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Standard deviation of domain lengths | 15.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YWM1 | 154-271 | VFRSREAARQVLEECTSIIPESRLVLELVDKCPKHPKKGNFPLIVIEGLDATGKTTVTHFLKDSLDAVLLRTPPSCVGQWRKIFDDE… |
| A0A1W4XRA6 | 3-135 | MIFHKFEEVRNLLNDPKYRHLEPVNKLWDIYNTVKNAKKDTLNQNEGENLRKHPLIVIEGLDGSGKTTITYKLAEKIKAALYRTPPL… |
| F6TFV0 | 164-313 | None |
| K0RN92 | 6-152 | None |
| D2HGH1 | 3-125 | None |
| K0S577 | 7-152 | None |
| A0A1S3J466 | 244-370 | None |
| A0A1B6KQB2 | 27-158 | None |
| A0A4Z2IRH3 | 177-312 | None |
| A0A6B0RMF6 | 9-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.