DPCstruct | MC52079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 158 ± 27 aa |
| Standard deviation of domain lengths | 27.09 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2C4J1 | 302-479 | LLTFLPQYALGYLGMPRRYYTYNADIAGWPELNLLSTLGAYILGLGGLVWVYGMLKSLRSGEKAPANPWGGYTLEWLTDSPPKAHNF… |
| T1B6W9 | 2-158 | VVALGGTLIIFGGILCQILQLTFSIRNRAQLRDETGDPWDGRTLEWSIPSPPPAYNFARIPQIHTRDAFHSMKKQARHAEEVDYEAI… |
| A0A838NDI1 | 51-215 | None |
| A0A7C3MNV1 | 60-186 | None |
| A0A1E3H4G4 | 11-188 | None |
| A0A525PKH7 | 19-175 | None |
| A0A7Y2JQM2 | 78-229 | None |
| V9G6I5 | 2-104 | None |
| A0A6A5L1P5 | 489-673 | None |
| A0A0D6ZE25 | 147-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.