DPCstruct | MC52077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 535 |
|---|---|
| Mean domain length (aa) | 175 ± 45 aa |
| Standard deviation of domain lengths | 44.76 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.32 |
| Pfam Score | 99.29 |
| Assigned Pfam label(s) | CL0023- PF01425- CL0269- PF00857 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2SJH5 | 24-201 | PHGNIGLLIVDFVVGFADPATFGGGNIAPAIARTTRALALARERGWSVAHSRIVYAEDGSDDNVFSLKVPGMATLTEHHPNSAIVPE… |
| A0A2T3JIG9 | 3-181 | KALVIIDFINDIVDKNGKIPSCAEQVSAHHVIHNANIAIQWARENNVPCIFIKVGFQSSYLELPHQSPMFGKAQQYRALELGHWGTD… |
| A0A1W1X6X5 | 4-269 | None |
| A0A7R9A2J4 | 231-397 | None |
| A0A1X7AJ46 | 69-226 | None |
| A0A0G4HQD9 | 157-332 | None |
| A0A6G0XHW0 | 7-272 | None |
| A0A7R9A3W7 | 106-284 | None |
| A0A5E8HE15 | 10-208 | None |
| A0A1Q9CNG1 | 578-884 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.