DPCstruct | MC52071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 94.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16483 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7SPK0 | 27-132 | YVMDKPTTAQVFAGDGPLVGNHEQGTVFAQVDAAFNRGVAASPDQGGTVAAYYPADTSYSAYAQVFHELGLDGKNYGFPYDDVNSQR… |
| A0A816BFE0 | 34-117 | LLCNGRLQESPDIGSAIKRHVFENKSDWTNAANYNKAAPANFYAKFWHDQSMNGLAYGFVYDDFNDQASYLQVHDPKGLIIRMG |
| A0A1C4P357 | 1-81 | None |
| A0A1M5T8I7 | 1021-1136 | None |
| A0A413RAL1 | 969-1076 | None |
| A0A2V1CQZ7 | 297-433 | None |
| R6FPU3 | 704-811 | None |
| A0A232M1I6 | 221-357 | None |
| A0A7Y6X561 | 229-383 | None |
| A0A4T0EHC2 | 84-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.