DPCstruct | MC5207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 143 ± 8 aa |
| Standard deviation of domain lengths | 7.82 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820R6R0 | 262-406 | AAPPRPPLPILEPTNDEIYDKDLPIPQSNQPILMAAHDLHMNIKQYSSHDNELIALAKKMSHFVAQLSLLIRGETGTKRDLISISRE… |
| A0A1S3JKU1 | 589-736 | LPQESVPPRPPPPETDDEDEETFERRYPEPQANQPIMMAAHALHREVKQWSSKDNEIIAAAKRMAMLMAKLSQLVRGDGGSKKELIA… |
| B4H371 | 76-222 | None |
| A0A7R9LWC9 | 1-128 | None |
| A0A016U7T7 | 318-469 | None |
| A0A430Q4Q3 | 239-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.