DPCstruct | MC52068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 822 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.45 |
| Pfam Score | 71.32 |
| Assigned Pfam label(s) | CL0689- CL0220- PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3T9U7 | 35-94 | GSITLLGGDANNDNVVNIFDLTIVGVAYGTSPPSDPRADINNDNIVNILDLVLVGGNYDK |
| A0A3S0BZK1 | 12-74 | WWPHPCAGDVNGDRIVNVLDASVIAGNWLQTVTPGTNGDLDLDGVVNLSDLVIVGANYGNICR |
| A0A846PE43 | 102-166 | None |
| A0A7C2PV24 | 139-203 | None |
| A0A7C2PVX8 | 57-122 | None |
| A0A7C2PWP6 | 591-650 | None |
| A0A7C2QAZ5 | 89-157 | None |
| A0A7C2QBY0 | 1035-1089 | None |
| A0A2H5WV24 | 97-150 | None |
| A0A843CVW1 | 175-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.