DPCstruct | MC52063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 204 ± 39 aa |
| Standard deviation of domain lengths | 39.47 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0016- CL0137- PF03348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N8Y0X3 | 11-226 | EKIKCFGFDMDYTLAVYKSPEYESLGFDLTVERLVSIGYPQELLNFVYDPSFPTRGLVFDTMYGTLLKVDAYGNILVCVHGFNFLRG… |
| A0A0V0ZES9 | 23-227 | LDLSEIDVYGFDYDYTLAIYRKSYFNCSSVKNDAVDAIFILWYPRELENMAYDPDFFVRGLHFDLSTNILLKMDAFCNIQKGTAHRG… |
| A0A183QQ15 | 9-180 | None |
| A0A0N5CX05 | 516-751 | None |
| A0A5K4F9F8 | 18-255 | None |
| A0A1V9Z4U8 | 161-416 | None |
| A0A820W664 | 52-292 | None |
| A0A2N9GM78 | 31-224 | None |
| A0A183SP55 | 13-214 | None |
| A0A834UFD7 | 102-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.