DPCstruct | MC52060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 205 ± 48 aa |
| Standard deviation of domain lengths | 48.15 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 89.44 |
| Assigned Pfam label(s) | PF07773- PF02990- PF09773- PF04597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6FFR0 | 264-460 | SLVRSDTENHSYKAGDPVPLYVNKVGPYQNPSESYSYFDLPFCQPDNFKKKNRTLSELLSGDNLIKAPYELEFLVEKRLEIACSKTL… |
| A0A1Y2C5A8 | 2-162 | GDMVPIECPQIHSNGTISSTVYAPFHCADTNTPLQLPYGLDAMLQCVWSLDEGMYNMISNSLDMKASYTCRVPMSKEASIYFPLTFS… |
| A0A316ZMV5 | 29-238 | None |
| A0A0V0QRI8 | 887-1102 | None |
| A0A6I9K5R2 | 18-293 | None |
| A0A7R9U9V8 | 19-197 | None |
| K8F316 | 32-246 | None |
| A0A654HUA8 | 22-186 | None |
| F4Q874 | 307-484 | None |
| A0A813TSM1 | 7-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.