DPCstruct | MC5206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 122 ± 20 aa |
| Standard deviation of domain lengths | 20.10 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J0V3 | 1-85 | MNLLQLDINQCPSMYSTPNAFKDTHKCDRKTSTCVPILGRGYETGGYKCECLQGYEYPFENAITYYDGQLVEAEFTNLVVNTQTR |
| A0A1W4XQC1 | 1-116 | MDMLKLDINQCPDEYYVPNAFKDTHKCDKRNSWCVPILGRGFESGGYKCECKQGYEYPFEDLITYYDGQLLEAEFLNLVDNNETRFN… |
| A0A1I8IUR5 | 113-238 | None |
| A0A183WD31 | 1-118 | None |
| A0A1D2NL70 | 337-500 | None |
| A0A1I8I2D2 | 443-577 | None |
| A0A814UDA7 | 637-750 | None |
| A0A267FTW9 | 331-483 | None |
| A0A815TYC6 | 49-163 | None |
| A0A820KAY7 | 75-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.